Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (5 PDB entries) |
Domain d2vl9b_: 2vl9 B: [168680] automated match to d1oc3a_ |
PDB Entry: 2vl9 (more details), 2.7 Å
SCOPe Domain Sequences for d2vl9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl9b_ c.47.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae alkakgvqvvaslsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
Timeline for d2vl9b_: