Lineage for d1oc3a_ (1oc3 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169154Protein Peroxiredoxin 5 [64066] (1 species)
  7. 1169155Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries)
    Uniprot P30044
  8. 1169166Domain d1oc3a_: 1oc3 A: [92767]
    complexed with bez

Details for d1oc3a_

PDB Entry: 1oc3 (more details), 2 Å

PDB Description: human peroxiredoxin 5
PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d1oc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oc3a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqa
ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOPe Domain Coordinates for d1oc3a_:

Click to download the PDB-style file with coordinates for d1oc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1oc3a_: