Lineage for d2vgfc3 (2vgf C:440-573)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993924Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 993925Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 993926Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 993927Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 993948Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)
  8. 993959Domain d2vgfc3: 2vgf C:440-573 [168560]
    Other proteins in same PDB: d2vgfa1, d2vgfa2, d2vgfb1, d2vgfb2, d2vgfc1, d2vgfc2, d2vgfd1, d2vgfd2
    complexed with fbp, k, mn, pga; mutant

Details for d2vgfc3

PDB Entry: 2vgf (more details), 2.75 Å

PDB Description: human erythrocyte pyruvate kinase: t384m mutant
PDB Compounds: (C:) pyruvate kinase isozymes r/l

SCOPe Domain Sequences for d2vgfc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgfc3 c.49.1.1 (C:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

SCOPe Domain Coordinates for d2vgfc3:

Click to download the PDB-style file with coordinates for d2vgfc3.
(The format of our PDB-style files is described here.)

Timeline for d2vgfc3: