Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (11 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [188418] (3 PDB entries) |
Domain d2vc5d_: 2vc5 D: [168453] automated match to d2d2ga1 complexed with co, edo, fe, gol |
PDB Entry: 2vc5 (more details), 2.6 Å
SCOPe Domain Sequences for d2vc5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vc5d_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev iatifkenpkkffs
Timeline for d2vc5d_: