Lineage for d2vc5d_ (2vc5 D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1342051Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1342052Protein automated matches [190150] (16 species)
    not a true protein
  7. 1342117Species Sulfolobus solfataricus [TaxId:2287] [188418] (10 PDB entries)
  8. 1342149Domain d2vc5d_: 2vc5 D: [168453]
    automated match to d2d2ga1
    complexed with co, edo, fe, gol

Details for d2vc5d_

PDB Entry: 2vc5 (more details), 2.6 Å

PDB Description: structural basis for natural lactonase and promiscuous phosphotriesterase activities
PDB Compounds: (D:) aryldialkylphosphatase

SCOPe Domain Sequences for d2vc5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vc5d_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

SCOPe Domain Coordinates for d2vc5d_:

Click to download the PDB-style file with coordinates for d2vc5d_.
(The format of our PDB-style files is described here.)

Timeline for d2vc5d_: