Lineage for d2uvdd_ (2uvd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2842983Species Bacillus anthracis [TaxId:198094] [188031] (1 PDB entry)
  8. 2842987Domain d2uvdd_: 2uvd D: [168180]
    automated match to d1q7ba_

Details for d2uvdd_

PDB Entry: 2uvd (more details), 2.4 Å

PDB Description: the crystal structure of a 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis (ba3989)
PDB Compounds: (D:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d2uvdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvdd_ c.2.1.2 (D:) automated matches {Bacillus anthracis [TaxId: 198094]}
mlkgkvalvtgasrgigraiaidlakqganvvvnyagneqkanevvdeikklgsdaiavr
advanaedvtnmvkqtvdvfgqvdilvnnagvtkdnllmrmkeeewdtvintnlkgvflc
tkavsrfmmrqrhgrivniasvvgvtgnpgqanyvaakagvigltktsakelasrnitvn
aiapgfiatdmtdvldenikaemlklipaaqfgeaqdianavtffasdqskyitgqtlnv
dggmvm

SCOPe Domain Coordinates for d2uvdd_:

Click to download the PDB-style file with coordinates for d2uvdd_.
(The format of our PDB-style files is described here.)

Timeline for d2uvdd_: