Lineage for d2rb3d1 (2rb3 D:3-79)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2716985Protein Saposin C [89077] (1 species)
  7. 2716986Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)
  8. 2716999Domain d2rb3d1: 2rb3 D:3-79 [168040]
    Other proteins in same PDB: d2rb3a2, d2rb3b2, d2rb3c2, d2rb3d2
    automated match to d2gtga1
    complexed with gol, so4

Details for d2rb3d1

PDB Entry: 2rb3 (more details), 2.1 Å

PDB Description: crystal structure of human saposin d
PDB Compounds: (D:) Proactivator polypeptide

SCOPe Domain Sequences for d2rb3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rb3d1 a.64.1.1 (D:3-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
gfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil
vevmdpsfvclkigacp

SCOPe Domain Coordinates for d2rb3d1:

Click to download the PDB-style file with coordinates for d2rb3d1.
(The format of our PDB-style files is described here.)

Timeline for d2rb3d1: