Lineage for d2r90d_ (2r90 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216883Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1216884Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1216885Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1216946Protein automated matches [190549] (3 species)
    not a true protein
  7. 1216947Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (23 PDB entries)
  8. 1217032Domain d2r90d_: 2r90 D: [168012]
    automated match to d1ycka1

Details for d2r90d_

PDB Entry: 2r90 (more details), 2.8 Å

PDB Description: Crystal structure of cameline peptidoglycan recognition protein at 2.8A resolution
PDB Compounds: (D:) Peptidoglycan recognition protein

SCOPe Domain Sequences for d2r90d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r90d_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d2r90d_:

Click to download the PDB-style file with coordinates for d2r90d_.
(The format of our PDB-style files is described here.)

Timeline for d2r90d_: