Class a: All alpha proteins [46456] (290 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (5 families) Lipid-binding can promote conformational changes and oligomerisation in some members |
Family a.64.1.1: NKL-like [47863] (4 proteins) |
Protein Saposin C [89077] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries) |
Domain d2r1qa1: 2r1q A:3-79 [167924] Other proteins in same PDB: d2r1qa2 automated match to d2gtga1 |
PDB Entry: 2r1q (more details), 2.5 Å
SCOPe Domain Sequences for d2r1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1qa1 a.64.1.1 (A:3-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} gfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil vevmdpsfvclkigacp
Timeline for d2r1qa1: