PDB entry 2r1q

View 2r1q on RCSB PDB site
Description: Crystal Structure of Iodinated Human Saposin D in Space Group C2221
Class: lipid binding protein
Keywords: lipid binding protein, saposin, activator protein, sap, Alternative splicing, Disease mutation, Gaucher disease, Glycoprotein, GM2-gangliosidosis, Lipid metabolism, Lysosome, Metachromatic leukodystrophy, Sphingolipid metabolism
Deposited on 2007-08-23, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proactivator polypeptide
  Species: Homo sapiens [TaxId:9606]
  Gene: PSAP, GLBA, SAP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07602 (1-End)
    • expression tag (0)
  Domains in SCOPe 2.08: d2r1qa1, d2r1qa2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2r1qA (A:)
  agfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvliei
  lvevmdpsfvclkigacpshhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2r1qA (A:)
  agfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvliei
  lvevmdpsfvclkigacp