Lineage for d2qzxa_ (2qzx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802193Protein automated matches [190156] (5 species)
    not a true protein
  7. 2802445Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries)
  8. 2802450Domain d2qzxa_: 2qzx A: [167897]
    automated match to d1eaga_

Details for d2qzxa_

PDB Entry: 2qzx (more details), 2.5 Å

PDB Description: secreted aspartic proteinase (sap) 5 from candida albicans
PDB Compounds: (A:) Candidapepsin-5

SCOPe Domain Sequences for d2qzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzxa_ b.50.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
gpvavtlhneaitytaditvgsdnqklnvivdtgssdlwipdsnvicipkwrgdkgdfck
sagsyspassrtsqnlntrfdikygdgsyakgklykdtvgiggvsvrdqlfanvwstsar
kgilgigfqsgeatefdydnlpislrnqgiigkaayslylnsaeastgqiifggidkaky
sgslvdlpitsekkltvglrsvnvrgrnvdantnvlldsgttisyftrsivrnilyaiga
qmkfdsagnkvyvadcktsgtidfqfgnnlkisvpvseflfqtyytsgkpfpkcevrire
sednilgdnflrsayvvynlddkkismapvkytsesdivain

SCOPe Domain Coordinates for d2qzxa_:

Click to download the PDB-style file with coordinates for d2qzxa_.
(The format of our PDB-style files is described here.)

Timeline for d2qzxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qzxb_