Lineage for d2qysb_ (2qys B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978437Species Ocimum basilicum [TaxId:39350] [188465] (7 PDB entries)
  8. 978447Domain d2qysb_: 2qys B: [167887]
    automated match to d1qyca_

Details for d2qysb_

PDB Entry: 2qys (more details), 1.8 Å

PDB Description: structure of eugenol synthase from ocimum basilicum
PDB Compounds: (B:) Eugenol synthase 1

SCOPe Domain Sequences for d2qysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qysb_ c.2.1.0 (B:) automated matches {Ocimum basilicum [TaxId: 39350]}
gmkskilifggtgyignhmvkgslklghptyvftrpnsskttlldefqslgaiivkgeld
eheklvelmkkvdvvisalafpqildqfkileaikvagnikrflpsdfgveedrinalpp
fealierkrmirraieeanipytyvsancfasyfinyllrpydpkdeitvygtgeakfam
nyeqdiglytikvatdpralnrvviyrpstniitqlelisrwekkigkkfkkihvpeeei
valtkelpepenipiailhclfidgatmsydfkendveastlypelkfttidelldifvh
dppppasaaf

SCOPe Domain Coordinates for d2qysb_:

Click to download the PDB-style file with coordinates for d2qysb_.
(The format of our PDB-style files is described here.)

Timeline for d2qysb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qysa_