Lineage for d2qfnb_ (2qfn B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075024Protein Dehaloperoxidase [46530] (1 species)
  7. 1075025Species Amphitrite ornata [TaxId:129555] [46531] (20 PDB entries)
  8. 1075036Domain d2qfnb_: 2qfn B: [167568]
    automated match to d1ew6a_
    complexed with hem, nh4, oxy, so4

Details for d2qfnb_

PDB Entry: 2qfn (more details), 1.62 Å

PDB Description: x-ray crystal structure analysis of the binding site in the ferric and oxyferrous forms of the recombinant heme dehaloperoxidase cloned from amphitrite ornata
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d2qfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfnb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdsvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d2qfnb_:

Click to download the PDB-style file with coordinates for d2qfnb_.
(The format of our PDB-style files is described here.)

Timeline for d2qfnb_: