SCOPe 2.01: Domain d2qfnb_: 2qfn B:

Lineage for d2qfnb_ (2qfn B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)

8. Domain d2qfnb_: 2qfn B: [167568]
   automated match to d1ew6a_
   complexed with hem, nh4, oxy, so4

Details for d2qfnb_

PDB Entry: 2qfn, 1.62 Å

PDB Description: x-ray crystal structure analysis of the binding site in the ferric and oxyferrous forms of the recombinant heme dehaloperoxidase cloned from amphitrite ornata

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d2qfnb_:

Sequence; same for both SEQRES and ATOM records:

>d2qfnb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdsvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d2qfnb_:

• d2qfnb_ is new in SCOPe 2.01-stable
  
• d2qfnb_ appears in SCOPe 2.02
  
• d2qfnb_ appears in the current release, SCOPe 2.08