SCOPe 2.01: Domain d2pvta_: 2pvt A:

Lineage for d2pvta_ (2pvt A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (26 PDB entries)

8. Domain d2pvta_: 2pvt A: [167288]
   automated match to d1cl5a_

Details for d2pvta_

PDB Entry: 2pvt, 2.1 Å

PDB Description: Crystal structure of a new isoform of phospholipase A2 from russells viper at 2.1 A resolution

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d2pvta_:

Sequence; same for both SEQRES and ATOM records:

>d2pvta_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sliefgkmileetgklaipsyssygcycggggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcedgtscqnricecdkaaaicfrqnlttysekyelypdflckgkik
c

Timeline for d2pvta_:

• d2pvta_ is new in SCOPe 2.01-stable
  
• d2pvta_ appears in SCOPe 2.02
  
• d2pvta_ appears in the current release, SCOPe 2.08