Lineage for d2pvea_ (2pve A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587652Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2587778Protein automated matches [190785] (6 species)
    not a true protein
  7. 2587779Species Clostridium pasteurianum [TaxId:1501] [188301] (1 PDB entry)
  8. 2587780Domain d2pvea_: 2pve A: [167282]
    automated match to d1t9pa_
    complexed with act, edo, zn

Details for d2pvea_

PDB Entry: 2pve (more details), 0.79 Å

PDB Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d2pvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvea_ g.41.5.1 (A:) automated matches {Clostridium pasteurianum [TaxId: 1501]}
mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeev

SCOPe Domain Coordinates for d2pvea_:

Click to download the PDB-style file with coordinates for d2pvea_.
(The format of our PDB-style files is described here.)

Timeline for d2pvea_: