PDB entry 2pve

View 2pve on RCSB PDB site
Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
Class: electron transport
Keywords: rubredoxin, ultrahigh resolution, ELECTRON TRANSPORT
Deposited on 2007-05-09, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.79 Å
R-factor: 0.112
AEROSPACI score: 1.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvea_
  • Chain 'B':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pveb_
  • Chain 'C':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-End)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvec_
  • Heterogens: ZN, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pveA (A:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pveA (A:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pveB (B:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pveB (B:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pveC (C:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pveC (C:)
    mkkytckicgyiynpedgdpdngvnpgtdfkdipddwvcpicgapksefeev