Lineage for d2pgaf_ (2pga F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888382Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
    Uniprot P0A1F6
  8. 2888429Domain d2pgaf_: 2pga F: [167176]
    automated match to d1ryza_
    complexed with anu, k, po4

Details for d2pgaf_

PDB Entry: 2pga (more details), 1.74 Å

PDB Description: x-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate and potassium ion at 1.74 a resolution
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d2pgaf_:

Sequence, based on SEQRES records: (download)

>d2pgaf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d2pgaf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeshavkivveaarrll

SCOPe Domain Coordinates for d2pgaf_:

Click to download the PDB-style file with coordinates for d2pgaf_.
(The format of our PDB-style files is described here.)

Timeline for d2pgaf_: