Lineage for d2oy0a_ (2oy0 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000000Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 1000043Protein automated matches [190302] (5 species)
    not a true protein
  7. 1000059Species West Nile virus [TaxId:11082] [187969] (1 PDB entry)
  8. 1000060Domain d2oy0a_: 2oy0 A: [166919]
    automated match to d1r6aa_
    complexed with sah

Details for d2oy0a_

PDB Entry: 2oy0 (more details), 2.8 Å

PDB Description: Crystal structure of the West Nile virus methyltransferase
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d2oy0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oy0a_ c.66.1.25 (A:) automated matches {West Nile virus [TaxId: 11082]}
rtlgevwkerlnqmtkeeftryrkeaiievdrsaakharkegnvtgghpvsrgtaklrwl
verrflepvgkvidlgcgrggwcyymatqkrvqevrgytkggpgheepqlvqsygwnivt
mksgvdvfyrpseccdtllcdigessssaeveehrtirvlemvedwlhrgprefcvkvlc
pympkviekmellqrryggglvrnplsrnsthemywvsrasgnvvhsvnmtsqvllgrme
krtwkgpqyeedvnlgsgtrav

SCOPe Domain Coordinates for d2oy0a_:

Click to download the PDB-style file with coordinates for d2oy0a_.
(The format of our PDB-style files is described here.)

Timeline for d2oy0a_: