Lineage for d2ovda_ (2ovd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804796Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries)
  8. 2804810Domain d2ovda_: 2ovd A: [166868]
    automated match to d1iw2a_
    complexed with dao

Details for d2ovda_

PDB Entry: 2ovd (more details), 1.8 Å

PDB Description: crystal structure of human complement protein c8gamma with laurate
PDB Compounds: (A:) Complement component 8, gamma polypeptide

SCOPe Domain Sequences for d2ovda_:

Sequence, based on SEQRES records: (download)

>d2ovda_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spistiqpkanfdaqqfagtwllvavgsaarflqeqghraeattlhvapqgtamavstfr
kldgicwqvrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvkl
yarslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records): (download)

>d2ovda_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spistiqpkanfdaqqfagtwllvavgsaaraeattlhvapqgtamavstfrkldgicwq
vrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvklyarslpvs
dsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

SCOPe Domain Coordinates for d2ovda_:

Click to download the PDB-style file with coordinates for d2ovda_.
(The format of our PDB-style files is described here.)

Timeline for d2ovda_: