SCOPe 2.01: Domain d2nnea_: 2nne A:

Lineage for d2nnea_ (2nne A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188249] (7 PDB entries)

8. Domain d2nnea_: 2nne A: [166313]
   automated match to d1df3a_
   complexed with cd, gol

Details for d2nnea_

PDB Entry: 2nne, 1.6 Å

PDB Description: the structural identification of the interaction site and functional state of rbp for its membrane receptor

PDB Compounds: (A:) Major urinary protein 2

SCOPe Domain Sequences for d2nnea_:

Sequence, based on SEQRES records:

>d2nnea_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhgrv
rllnnwdcselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfql
mglygrepdlssdikerfaqlceehgilreniidlsna

Sequence, based on observed residues (ATOM records):

>d2nnea_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhgse
lsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmglygrepdl
ssdikerfaqlceehgilreniidlsna

Timeline for d2nnea_:

• d2nnea_ is new in SCOPe 2.01-stable
  
• d2nnea_ appears in SCOPe 2.02
  
• d2nnea_ appears in the current release, SCOPe 2.08