Lineage for d2nm0b_ (2nm0 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978497Species Streptomyces coelicolor [TaxId:100226] [187919] (1 PDB entry)
  8. 978499Domain d2nm0b_: 2nm0 B: [166302]
    automated match to d1uzla1

Details for d2nm0b_

PDB Entry: 2nm0 (more details), 1.99 Å

PDB Description: crystal structure of sco1815: a beta-ketoacyl-acyl carrier protein reductase from streptomyces coelicolor a3(2)
PDB Compounds: (B:) Probable 3-oxacyl-(Acyl-carrier-protein) reductase

SCOPe Domain Sequences for d2nm0b_:

Sequence, based on SEQRES records: (download)

>d2nm0b_ c.2.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
msrsvlvtggnrgiglaiarafadagdkvaityrsgeppegflavkcditdteqveqayk
eieethgpvevlianagvtkdqllmrmseedftsvvetnltgtfrvvkranramlrakkg
rvvlissvvgllgsagqanyaaskaglvgfarslarelgsrnitfnvvapgfvdtdmtkv
ltdeqranivsqvplgryarpeeiaatvrflasddasyitgavipvdgglgmg

Sequence, based on observed residues (ATOM records): (download)

>d2nm0b_ c.2.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
msrsvlvtggnrgiglaiarafadagdkvaityrsgeppegflavkcditdteqveqayk
eieethgpvevlianagvtkdqlmseedftsvvetnltgtfrvvkranramlrakkgrvv
lissvvgllgsagqanyaaskaglvgfarslarelgsrnitfnvvapgfvdtqranivsq
vplgryarpeeiaatvrflasddasyitgavipvdgglgmg

SCOPe Domain Coordinates for d2nm0b_:

Click to download the PDB-style file with coordinates for d2nm0b_.
(The format of our PDB-style files is described here.)

Timeline for d2nm0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nm0a_