SCOPe 2.01: Domain d2jara_: 2jar A:

Lineage for d2jara_ (2jar A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188278] (2 PDB entries)

8. Domain d2jara_: 2jar A: [165968]
   automated match to d1z4ia1
   complexed with mg, ump

Details for d2jara_

PDB Entry: 2jar, 1.94 Å

PDB Description: crystal structure of d12n variant of mouse cytosolic 5'(3')- deoxyribonucleotidase (cdn) in complex with deoxyuridine 5'- monophosphate

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d2jara_:

Sequence; same for both SEQRES and ATOM records:

>d2jara_ c.108.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krpvrvlvnmdgvladfesgllqgfrrrfpeephvpleqrrgflaneqygalrpdlaekv
asvyespgfflnlepipgaldalremndmkdtevficttpllkydhcvgekyrwveqnlg
pefveriiltrdktvvmgdlliddkdniqgleetpswehilftcchnqhlalpptrrrll
swsdnwrgiieskras

Timeline for d2jara_:

• d2jara_ is new in SCOPe 2.01-stable
  
• d2jara_ appears in SCOPe 2.02
  
• d2jara_ appears in the current release, SCOPe 2.08