SCOPe 2.01: Domain d2j9jb_: 2j9j B:

Lineage for d2j9jb_ (2j9j B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries)

8. Domain d2j9jb_: 2j9j B: [165955]
   automated match to d1b6ka_
   protein/DNA complex; protein/RNA complex; complexed with act, gol, so4

Details for d2j9jb_

PDB Entry: 2j9j, 1.04 Å

PDB Description: atomic-resolution crystal structure of chemically-synthesized hiv-1 protease complexed with inhibitor jg-365

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2j9jb_:

Sequence; same for both SEQRES and ATOM records:

>d2j9jb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggnlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d2j9jb_:

• d2j9jb_ is new in SCOPe 2.01-stable
  
• d2j9jb_ appears in SCOPe 2.02
  
• d2j9jb_ appears in the current release, SCOPe 2.08