Lineage for d2j9ja_ (2j9j A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 956189Protein automated matches [190433] (10 species)
    not a true protein
  7. 956217Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries)
  8. 956218Domain d2j9ja_: 2j9j A: [165954]
    automated match to d1b6ka_
    protein/DNA complex; protein/RNA complex; complexed with act, gol, so4

Details for d2j9ja_

PDB Entry: 2j9j (more details), 1.04 Å

PDB Description: atomic-resolution crystal structure of chemically-synthesized hiv-1 protease complexed with inhibitor jg-365
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2j9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ja_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d2j9ja_:

Click to download the PDB-style file with coordinates for d2j9ja_.
(The format of our PDB-style files is described here.)

Timeline for d2j9ja_: