SCOPe 2.01: Domain d2i7da_: 2i7d A:

Lineage for d2i7da_ (2i7d A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (9 PDB entries)

8. Domain d2i7da_: 2i7d A: [165420]
   automated match to d1mh9a_
   complexed with alf, dur, mg

Details for d2i7da_

PDB Entry: 2i7d, 1.2 Å

PDB Description: Structure of Human cytosolic deoxyribonucleotidase in complex with deoxyuridine, AlF4 and Mg2+

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase, cytosolic type

SCOPe Domain Sequences for d2i7da_:

Sequence; same for both SEQRES and ATOM records:

>d2i7da_ c.108.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkva
svyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgp
qfveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrlls
wsdnwreildskr

Timeline for d2i7da_:

• d2i7da_ is new in SCOPe 2.01-stable
  
• d2i7da_ appears in SCOPe 2.02
  
• d2i7da_ appears in the current release, SCOPe 2.08