![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (3 species) not a true protein |
![]() | Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [187780] (1 PDB entry) |
![]() | Domain d2h1ka_: 2h1k A: [164912] automated match to d1ahdp_ protein/DNA complex |
PDB Entry: 2h1k (more details), 2.42 Å
SCOPe Domain Sequences for d2h1ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1ka_ a.4.1.0 (A:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} rtrtaytraqllelekeflfnkyisrprrvelavmlnlterhikiwfqnrrmkwkkee
Timeline for d2h1ka_: