Lineage for d1ahdp_ (1ahd P:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1078588Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1078589Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1078590Protein Antennapedia Homeodomain [46716] (1 species)
  7. 1078591Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)
  8. 1078594Domain d1ahdp_: 1ahd P: [16006]
    protein/DNA complex; mutant

Details for d1ahdp_

PDB Entry: 1ahd (more details)

PDB Description: determination of the nmr solution structure of an antennapedia homeodomain-dna complex
PDB Compounds: (P:) Antennapedia Protein Mutant

SCOPe Domain Sequences for d1ahdp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahdp_ a.4.1.1 (P:) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
nktkgepg

SCOPe Domain Coordinates for d1ahdp_:

Click to download the PDB-style file with coordinates for d1ahdp_.
(The format of our PDB-style files is described here.)

Timeline for d1ahdp_: