Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Dephospho-CoA kinase [75187] (4 species) |
Species Thermotoga maritima [TaxId:2336] [187766] (1 PDB entry) |
Domain d2grjd_: 2grj D: [164818] automated match to d1jjva_ complexed with adp, cl, cod |
PDB Entry: 2grj (more details), 2.6 Å
SCOPe Domain Sequences for d2grjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grjd_ c.37.1.1 (D:) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]} hhhmvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvled gkvnrkklagivfesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldql cdhvitvvasretilkrnreadrrlkfqedivpqgivvannstledlekkveevmklvw
Timeline for d2grjd_: