Lineage for d2grjc_ (2grj C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593779Protein Dephospho-CoA kinase [75187] (4 species)
  7. 1593798Species Thermotoga maritima [TaxId:2336] [187766] (1 PDB entry)
  8. 1593801Domain d2grjc_: 2grj C: [164817]
    automated match to d1jjva_
    complexed with adp, cl, cod

Details for d2grjc_

PDB Entry: 2grj (more details), 2.6 Å

PDB Description: crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution
PDB Compounds: (C:) dephospho-coa kinase

SCOPe Domain Sequences for d2grjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grjc_ c.37.1.1 (C:) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]}
hhhmvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvled
gkvnrkklagivfesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldql
cdhvitvvasretilkrnreadrrlkfqedivpqgivvannstledlekkveevmklvw

SCOPe Domain Coordinates for d2grjc_:

Click to download the PDB-style file with coordinates for d2grjc_.
(The format of our PDB-style files is described here.)

Timeline for d2grjc_: