![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Dephospho-CoA kinase [75187] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [187766] (1 PDB entry) |
![]() | Domain d2grjb_: 2grj B: [164816] automated match to d1jjva_ complexed with adp, cl, cod |
PDB Entry: 2grj (more details), 2.6 Å
SCOPe Domain Sequences for d2grjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grjb_ c.37.1.1 (B:) Dephospho-CoA kinase {Thermotoga maritima [TaxId: 2336]} hhhmvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvled gkvnrkklagivfesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldql cdhvitvvasretilkrnreadrrlkfqedivpqgivvannstledlekkveevmklvw
Timeline for d2grjb_: