Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (33 PDB entries) |
Domain d1aoig_: 1aoi G: [16441] Other proteins in same PDB: d1aoia_, d1aoib_, d1aoid_, d1aoie_, d1aoif_, d1aoih_ protein/DNA complex; complexed with mn |
PDB Entry: 1aoi (more details), 2.8 Å
SCOPe Domain Sequences for d1aoig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoig_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
Timeline for d1aoig_: