SCOPe 2.08: Domain d2ffqa1: 2ffq A:13-174

Lineage for d2ffqa1 (2ffq A:13-174)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2ffqa1: 2ffq A:13-174 [164340]
   Other proteins in same PDB: d2ffqa2
   automated match to d1yzqa1
   complexed with gsp, mg

Details for d2ffqa1

PDB Entry: 2ffq, 1.78 Å

PDB Description: The crystal structure of human neuronal Rab6B in its active GTPgS-bound form

PDB Compounds: (A:) Ras-related protein Rab-6B

SCOPe Domain Sequences for d2ffqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ffqa1 c.37.1.8 (A:13-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
erfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdlad
krqitieegeqrakelsvmfietsaktgynvkqlfrrvasal

Timeline for d2ffqa1:

• d2ffqa1 first appeared in SCOPe 2.01, called d2ffqa_
  
• d2ffqa1 appears in SCOPe 2.07