Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (50 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (8 PDB entries) |
Domain d2fa4b_: 2fa4 B: [164308] automated match to d1erva_ |
PDB Entry: 2fa4 (more details), 2.38 Å
SCOPe Domain Sequences for d2fa4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fa4b_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvtqlksaseydsalasgdklvvvdffatwcgpckmiapmiekfaeqysdaafykldvde vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv
Timeline for d2fa4b_: