Lineage for d2fa4a_ (2fa4 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169725Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1169726Protein automated matches [190056] (50 species)
    not a true protein
  7. 1169758Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (8 PDB entries)
  8. 1169769Domain d2fa4a_: 2fa4 A: [164307]
    automated match to d1erva_

Details for d2fa4a_

PDB Entry: 2fa4 (more details), 2.38 Å

PDB Description: crystal structure of oxidized form from saccharomyces cerevisiae
PDB Compounds: (A:) Thioredoxin II

SCOPe Domain Sequences for d2fa4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fa4a_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtqlksaseydsalasgdklvvvdffatwcgpckmiapmiekfaeqysdaafykldvde
vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv

SCOPe Domain Coordinates for d2fa4a_:

Click to download the PDB-style file with coordinates for d2fa4a_.
(The format of our PDB-style files is described here.)

Timeline for d2fa4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fa4b_