![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (6 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries) |
![]() | Domain d2egkd_: 2egk D: [164012] automated match to d1gq5a_ complexed with po4 |
PDB Entry: 2egk (more details), 2.85 Å
SCOPe Domain Sequences for d2egkd_:
Sequence, based on SEQRES records: (download)
>d2egkd_ b.36.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdtiasv nglnvegirhreivdiikasgnvlrletlygteesql
>d2egkd_ b.36.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rkvltlekgdnqtfgfeiqtygmvtfvarvhesspaqlagltpgdtiasvnglnvegirh reivdiikasgnvlrletlygteesql
Timeline for d2egkd_: