Lineage for d2dtdb_ (2dtd B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978502Species Thermoplasma acidophilum [TaxId:2303] [187636] (4 PDB entries)
  8. 978508Domain d2dtdb_: 2dtd B: [163688]
    automated match to d2d1ya1
    complexed with so4

Details for d2dtdb_

PDB Entry: 2dtd (more details), 2.1 Å

PDB Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in ligand-free form
PDB Compounds: (B:) Glucose 1-dehydrogenase related protein

SCOPe Domain Sequences for d2dtdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtdb_ c.2.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
vdgglsirapistpe

SCOPe Domain Coordinates for d2dtdb_:

Click to download the PDB-style file with coordinates for d2dtdb_.
(The format of our PDB-style files is described here.)

Timeline for d2dtdb_: