SCOPe 2.01: Domain d2cfcb_: 2cfc B:

Lineage for d2cfcb_ (2cfc B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Xanthobacter autotrophicus [TaxId:78245] [187540] (1 PDB entry)

8. Domain d2cfcb_: 2cfc B: [163394]
   automated match to d1iy8a_
   complexed with kpc, nad

Details for d2cfcb_

PDB Entry: 2cfc, 1.8 Å

PDB Description: structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases

PDB Compounds: (B:) 2-(r)-hydroxypropyl-com dehydrogenase

SCOPe Domain Sequences for d2cfcb_:

Sequence; same for both SEQRES and ATOM records:

>d2cfcb_ c.2.1.0 (B:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
msrvaivtgassgnglaiatrflargdrvaaldlsaetleetarthwhayadkvlrvrad
vadegdvnaaiaatmeqfgaidvlvnnagitgnseagvlhttpveqfdkvmavnvrgifl
gcravlphmllqgagvivniasvaslvafpgrsayttskgavlqltksvavdyagsgirc
navcpgmietpmtqwrldqpelrdqvlaripqkeigtaaqvadavmflagedatyvngaa
lvmdgaytai

Timeline for d2cfcb_:

• d2cfcb_ is new in SCOPe 2.01-stable
  
• d2cfcb_ appears in SCOPe 2.02
  
• d2cfcb_ appears in the current release, SCOPe 2.08