Lineage for d1fjft_ (1fjf T:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95722Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 95791Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 95792Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 95793Protein Ribosomal protein S20 [46994] (1 species)
  7. 95794Species Thermus thermophilus [TaxId:274] [46995] (10 PDB entries)
  8. 95801Domain d1fjft_: 1fjf T: [16337]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjfv_

Details for d1fjft_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjft_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjft_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1fjft_:

Click to download the PDB-style file with coordinates for d1fjft_.
(The format of our PDB-style files is described here.)

Timeline for d1fjft_: