SCOP 1.59: Domain d1fjfl_: 1fjf L:

Lineage for d1fjfl_ (1fjf L:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)

6. Protein Ribosomal protein S12 [50302] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (10 PDB entries)

8. Domain d1fjfl_: 1fjf L: [25345]
   Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfl_

PDB Entry: 1fjf, 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfl_:

Sequence; same for both SEQRES and ATOM records:

>d1fjfl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1fjfl_:

• d1fjfl_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjfl_ appears in SCOP 1.57
  
• d1fjfl_ does not appear in SCOP 1.61