Lineage for d2beka_ (2bek A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1166517Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1166518Protein automated matches [190123] (28 species)
    not a true protein
  7. 1166680Species Thermus thermophilus [TaxId:262724] [187453] (3 PDB entries)
  8. 1166681Domain d2beka_: 2bek A: [163057]
    automated match to d1hyqa_
    complexed with atp, mg

Details for d2beka_

PDB Entry: 2bek (more details), 1.8 Å

PDB Description: structure of the bacterial chromosome segregation protein soj
PDB Compounds: (A:) segregation protein

SCOPe Domain Sequences for d2beka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2beka_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
kvrrialanqkggvgktttainlaaylarlgkrvllvdlapqgnatsglgvraergvyhl
lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls
pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl
laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma
rvqea

SCOPe Domain Coordinates for d2beka_:

Click to download the PDB-style file with coordinates for d2beka_.
(The format of our PDB-style files is described here.)

Timeline for d2beka_: