Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [187453] (11 PDB entries) |
Domain d2beka_: 2bek A: [163057] automated match to d1hyqa_ complexed with atp, mg |
PDB Entry: 2bek (more details), 1.8 Å
SCOPe Domain Sequences for d2beka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2beka_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]} kvrrialanqkggvgktttainlaaylarlgkrvllvdlapqgnatsglgvraergvyhl lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma rvqea
Timeline for d2beka_: