SCOPe 2.06: Domain d2b7za_: 2b7z A:

Lineage for d2b7za_ (2b7z A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)

8. Domain d2b7za_: 2b7z A: [163000]
   automated match to d1sgua_
   complexed with mk1; mutant

Details for d2b7za_

PDB Entry: 2b7z, 2.2 Å

PDB Description: structure of hiv-1 protease mutant bound to indinavir

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d2b7za_:

Sequence; same for both SEQRES and ATOM records:

>d2b7za_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkiiggiggfikvrqyd
qipieicghkvigtvlvgptpanvigrnlmtqigctlnf

Timeline for d2b7za_:

• d2b7za_ first appeared in SCOPe 2.01
  
• d2b7za_ appears in SCOPe 2.05
  
• d2b7za_ appears in SCOPe 2.07
  
• d2b7za_ appears in the current release, SCOPe 2.08