Lineage for d2aqsb_ (2aqs B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769113Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1769114Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1769127Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1769542Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries)
  8. 1769555Domain d2aqsb_: 2aqs B: [162872]
    automated match to d2apsa_
    complexed with cu, cu1, zn; mutant

Details for d2aqsb_

PDB Entry: 2aqs (more details), 1.7 Å

PDB Description: cu/zn superoxide dismutase from neisseria meningitidis k91e, k94e double mutant
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2aqsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqsb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]}
asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkee
egeltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
vrghsimihtggdnhsdhpaplggggprmacgvik

SCOPe Domain Coordinates for d2aqsb_:

Click to download the PDB-style file with coordinates for d2aqsb_.
(The format of our PDB-style files is described here.)

Timeline for d2aqsb_: