SCOPe 2.06: Domain d1zx6a_: 1zx6 A:

Lineage for d1zx6a_ (1zx6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)

8. Domain d1zx6a_: 1zx6 A: [162622]
   automated match to d1gfca_

Details for d1zx6a_

PDB Entry: 1zx6, 1.6 Å

PDB Description: High-resolution crystal structure of yeast Pin3 SH3 domain

PDB Compounds: (A:) Ypr154wp

SCOPe Domain Sequences for d1zx6a_:

Sequence; same for both SEQRES and ATOM records:

>d1zx6a_ b.34.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eyvealyqfdpqqdgdlglkpgdkvqlleklspewykgscngrtgifpanyvkpaf

Timeline for d1zx6a_:

• d1zx6a_ first appeared in SCOPe 2.01
  
• d1zx6a_ appears in SCOPe 2.05
  
• d1zx6a_ appears in SCOPe 2.07
  
• d1zx6a_ appears in the current release, SCOPe 2.08