Lineage for d1gfca_ (1gfc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783583Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 1783593Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 1783603Domain d1gfca_: 1gfc A: [24537]
    C-terminal domain

Details for d1gfca_

PDB Entry: 1gfc (more details)

PDB Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gfca_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

SCOPe Domain Coordinates for d1gfca_:

Click to download the PDB-style file with coordinates for d1gfca_.
(The format of our PDB-style files is described here.)

Timeline for d1gfca_: