Lineage for d1zmoa_ (1zmo A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978268Species Arthrobacter sp. [TaxId:168809] [188194] (1 PDB entry)
  8. 978269Domain d1zmoa_: 1zmo A: [162542]
    automated match to d1pwxa_

Details for d1zmoa_

PDB Entry: 1zmo (more details), 2 Å

PDB Description: Apo structure of haloalcohol dehalogenase HheA of Arthrobacter sp. AD2
PDB Compounds: (A:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmoa_ c.2.1.0 (A:) automated matches {Arthrobacter sp. [TaxId: 168809]}
vialvtharhfagpaavealtqdgytvvchdasfadaaerqrfesenpgtialaeqkper
lvdatlqhgeaidtivsndyiprpmnrlplegtseadirqmfealsifpilllqsaiapl
raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
nptyfptsdwennpelrervdrdvplgrlgrpdemgalitflasrraapivgqffaftgg
ylp

SCOPe Domain Coordinates for d1zmoa_:

Click to download the PDB-style file with coordinates for d1zmoa_.
(The format of our PDB-style files is described here.)

Timeline for d1zmoa_: