Lineage for d1yzva_ (1yzv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864403Species Trypanosoma cruzi [TaxId:5693] [188160] (1 PDB entry)
  8. 2864404Domain d1yzva_: 1yzv A: [162343]
    automated match to d1x9ga_
    complexed with so4

Details for d1yzva_

PDB Entry: 1yzv (more details), 2 Å

PDB Description: hypothetical protein from trypanosoma cruzi
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1yzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzva_ c.33.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
srllkhygscktaffccdiqekfmgriansancvfvanrfaglhtalgtahsvyivteqy
pkglgatsadirlppdahvfskkrfamlvpqvmplvdlpeveqvvlwgfethvcilqtaa
alldmkkkvviavdgcgsqsqgdhctaiqlmqswsgdgcyistsesilmqllkdasdpvf
ktiaplmkqthpiri

SCOPe Domain Coordinates for d1yzva_:

Click to download the PDB-style file with coordinates for d1yzva_.
(The format of our PDB-style files is described here.)

Timeline for d1yzva_: