Lineage for d1xdbb_ (1xdb B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1164938Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1165138Protein Nitrogenase iron protein [52661] (2 species)
  7. 1165139Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)
  8. 1165179Domain d1xdbb_: 1xdb B: [162061]
    automated match to d1de0a_
    complexed with sf4

Details for d1xdbb_

PDB Entry: 1xdb (more details), 2.8 Å

PDB Description: crystal structure of the nitrogenase fe protein asp129glu
PDB Compounds: (B:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xdbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdbb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgevvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

SCOPe Domain Coordinates for d1xdbb_:

Click to download the PDB-style file with coordinates for d1xdbb_.
(The format of our PDB-style files is described here.)

Timeline for d1xdbb_: