SCOPe 2.03: Domain d1xdbb_: 1xdb B:

Lineage for d1xdbb_ (1xdb B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)

8. Domain d1xdbb_: 1xdb B: [162061]
   automated match to d1de0a_
   complexed with sf4

Details for d1xdbb_

PDB Entry: 1xdb, 2.8 Å

PDB Description: crystal structure of the nitrogenase fe protein asp129glu

PDB Compounds: (B:) nitrogenase iron protein 1

SCOPe Domain Sequences for d1xdbb_:

Sequence; same for both SEQRES and ATOM records:

>d1xdbb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgevvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev

Timeline for d1xdbb_:

• d1xdbb_ first appeared in SCOPe 2.01
  
• d1xdbb_ appears in SCOPe 2.02
  
• d1xdbb_ appears in SCOPe 2.04
  
• d1xdbb_ appears in the current release, SCOPe 2.08